SCOPe 2.08: Domain d4n6ob1: 4n6o B:11-124

Lineage for d4n6ob1 (4n6o B:11-124)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.0: automated matches [191407] (1 protein)
   not a true family

6. Protein automated matches [190558] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187545] (8 PDB entries)

8. Domain d4n6ob1: 4n6o B:11-124 [269686]
   Other proteins in same PDB: d4n6ob2
   automated match to d1tija_
   complexed with iod

Details for d4n6ob1

PDB Entry: 4n6o, 1.8 Å

PDB Description: crystal structure of reduced legumain in complex with cystatin e/m

PDB Compounds: (B:) cystatin-M

SCOPe Domain Sequences for d4n6ob1:

Sequence; same for both SEQRES and ATOM records:

>d4n6ob1 d.17.1.0 (B:11-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagikyfltmemgs
tdcrktrvtgdhvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhncvqm

Timeline for d4n6ob1:

• d4n6ob1 first appeared in SCOPe 2.05, called d4n6ob_
  
• d4n6ob1 appears in SCOPe 2.07