| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) ![]() has a additional strand at the N-terminus |
| Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
| Protein automated matches [190558] (13 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187545] (8 PDB entries) |
| Domain d4n6mb_: 4n6m B: [269684] automated match to d1tija_ complexed with so4 |
PDB Entry: 4n6m (more details), 2.9 Å
SCOPe Domain Sequences for d4n6mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n6mb_ d.17.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgelrdlspddpqvqkaaqaavasynmgsnsiyyfrdthiikaqsqlvagikyfltmem
gstdcrktrvtgdhvdlttcplaagaqqeklrcdfevlvvpwqnssqllkhncvqm
Timeline for d4n6mb_: