![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) ![]() duplication: contains two subdomains of this fold |
![]() | Family d.58.32.0: automated matches [227166] (1 protein) not a true family |
![]() | Protein automated matches [226875] (3 species) not a true protein |
![]() | Species Maize (Zea mays) [TaxId:4577] [269671] (7 PDB entries) |
![]() | Domain d4mlaa2: 4mla A:235-515 [269682] Other proteins in same PDB: d4mlaa1, d4mlab1 automated match to d2qpma2 complexed with edo, fad, gol, ipa |
PDB Entry: 4mla (more details), 2.04 Å
SCOPe Domain Sequences for d4mlaa2:
Sequence, based on SEQRES records: (download)
>d4mlaa2 d.58.32.0 (A:235-515) automated matches {Maize (Zea mays) [TaxId: 4577]} pemvrwirvlysdfesftedqemlimaensfdyiegfviinrtgilnnwrasfkpqdpvq ashfqsdgrvlycleltknfnsgdtdtmeqevavllsrlrfiqstlfhtdvtylefldrv htselklraqslwevphpwlnlliprssirrfatevfgrilkdsnngpillypvnkskwd nktsvvipdeeifylvgflssapslsghgsiahamslnsqivefceeadigmkqylahyt tqeqwkthfgarwetferrkhrydplailapgqrifpkasl
>d4mlaa2 d.58.32.0 (A:235-515) automated matches {Maize (Zea mays) [TaxId: 4577]} pemvrwirvlysdfesftedqemlimaensfdyiegfviinrtgilnnwrasfkpqdprv lycleltknfnsgdtdtmeqevavllsrlrfiqstlfhtdvtylefldrvhtselklraq slwevphpwlnlliprssirrfatevfgrilkdsnngpillypvnkskwdnktsvvipde eifylvgflssapslsghgsiahamslnsqivefceeadigmkqylahyttqeqwkthfg arwetferrkhrydplailapgqrifpkasl
Timeline for d4mlaa2: