Lineage for d4mlaa2 (4mla A:235-515)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1911121Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (6 families) (S)
    duplication: contains two subdomains of this fold
  5. 1911215Family d.58.32.0: automated matches [227166] (1 protein)
    not a true family
  6. 1911216Protein automated matches [226875] (2 species)
    not a true protein
  7. 1911220Species Zea mays [TaxId:4577] [269671] (4 PDB entries)
  8. 1911224Domain d4mlaa2: 4mla A:235-515 [269682]
    Other proteins in same PDB: d4mlaa1, d4mlab1
    automated match to d2qpma2
    complexed with edo, fad, gol, ipa

Details for d4mlaa2

PDB Entry: 4mla (more details), 2.04 Å

PDB Description: structure of maize cytokinin oxidase/dehydrogenase 2 (zmcko2)
PDB Compounds: (A:) Cytokinin oxidase 2

SCOPe Domain Sequences for d4mlaa2:

Sequence, based on SEQRES records: (download)

>d4mlaa2 d.58.32.0 (A:235-515) automated matches {Zea mays [TaxId: 4577]}
pemvrwirvlysdfesftedqemlimaensfdyiegfviinrtgilnnwrasfkpqdpvq
ashfqsdgrvlycleltknfnsgdtdtmeqevavllsrlrfiqstlfhtdvtylefldrv
htselklraqslwevphpwlnlliprssirrfatevfgrilkdsnngpillypvnkskwd
nktsvvipdeeifylvgflssapslsghgsiahamslnsqivefceeadigmkqylahyt
tqeqwkthfgarwetferrkhrydplailapgqrifpkasl

Sequence, based on observed residues (ATOM records): (download)

>d4mlaa2 d.58.32.0 (A:235-515) automated matches {Zea mays [TaxId: 4577]}
pemvrwirvlysdfesftedqemlimaensfdyiegfviinrtgilnnwrasfkpqdprv
lycleltknfnsgdtdtmeqevavllsrlrfiqstlfhtdvtylefldrvhtselklraq
slwevphpwlnlliprssirrfatevfgrilkdsnngpillypvnkskwdnktsvvipde
eifylvgflssapslsghgsiahamslnsqivefceeadigmkqylahyttqeqwkthfg
arwetferrkhrydplailapgqrifpkasl

SCOPe Domain Coordinates for d4mlaa2:

Click to download the PDB-style file with coordinates for d4mlaa2.
(The format of our PDB-style files is described here.)

Timeline for d4mlaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mlaa1