Lineage for d4ml8a2 (4ml8 A:235-516)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1911121Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (6 families) (S)
    duplication: contains two subdomains of this fold
  5. 1911215Family d.58.32.0: automated matches [227166] (1 protein)
    not a true family
  6. 1911216Protein automated matches [226875] (2 species)
    not a true protein
  7. 1911220Species Zea mays [TaxId:4577] [269671] (4 PDB entries)
  8. 1911226Domain d4ml8a2: 4ml8 A:235-516 [269680]
    Other proteins in same PDB: d4ml8a1, d4ml8b1, d4ml8c1, d4ml8d1
    automated match to d2qpma2
    complexed with fad, peg

Details for d4ml8a2

PDB Entry: 4ml8 (more details), 2.7 Å

PDB Description: structure of maize cytokinin oxidase/dehydrogenase 2 (zmcko2)
PDB Compounds: (A:) Cytokinin oxidase 2

SCOPe Domain Sequences for d4ml8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ml8a2 d.58.32.0 (A:235-516) automated matches {Zea mays [TaxId: 4577]}
pemvrwirvlysdfesftedqemlimaensfdyiegfviinrtgilnnwrasfkpqdpvq
ashfqsdgrvlycleltknfnsgdtdtmeqevavllsrlrfiqstlfhtdvtylefldrv
htselklraqslwevphpwlnlliprssirrfatevfgrilkdsnngpillypvnkskwd
nktsvvipdeeifylvgflssapslsghgsiahamslnsqivefceeadigmkqylahyt
tqeqwkthfgarwetferrkhrydplailapgqrifpkaslp

SCOPe Domain Coordinates for d4ml8a2:

Click to download the PDB-style file with coordinates for d4ml8a2.
(The format of our PDB-style files is described here.)

Timeline for d4ml8a2: