Lineage for d1awe__ (1awe -)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.55: PH domain-like [50728] (1 superfamily)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helixSuperfamily b.55.1: PH domain-like [50729] (9 families) 
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (30 proteins)
Pfam 00169
Protein Son of sevenless-1 (sos-1) [50742] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50744] (4 PDB entries) 
Domain d1awe__: 1awe - [26968]
Details for d1awe__
PDB Entry: 1awe (more details)
PDB Description: human sos1 pleckstrin homology (ph) domain, nmr, 20 structures
SCOP Domain Sequences for d1awe__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1awe__ b.55.1.1 (-) Son of sevenless-1 (sos-1) {Human (Homo sapiens)}
mneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccksnhgqprlp
gasnaeyrlkekffmrkvqindkddtneykhafeiilkdensvifsaksaeeknnwmaal
islqyrstle
SCOP Domain Coordinates for d1awe__:
Click to download the PDB-style file with coordinates for d1awe__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1awe__:
- d1awe__ first appeared (with stable ids) in SCOP 1.55
- d1awe__ appears in SCOP 1.69
- d1awe__ is called d1awea_ in SCOP 1.73
- d1awe__ appears in the current release, SCOPe 2.08, called d1awea_
View in 3D