SCOPe 2.05: Domain d4ml8b1: 4ml8 B:29-234

Lineage for d4ml8b1 (4ml8 B:29-234)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.0: automated matches [191624] (1 protein)
   not a true family

6. Protein automated matches [191143] (7 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [225479] (14 PDB entries)

8. Domain d4ml8b1: 4ml8 B:29-234 [269675]
   Other proteins in same PDB: d4ml8a2, d4ml8b2, d4ml8c2, d4ml8d2
   automated match to d3s1da1
   complexed with fad, peg

Details for d4ml8b1

PDB Entry: 4ml8, 2.7 Å

PDB Description: structure of maize cytokinin oxidase/dehydrogenase 2 (zmcko2)

PDB Compounds: (B:) Cytokinin oxidase 2

SCOPe Domain Sequences for d4ml8b1:

Sequence; same for both SEQRES and ATOM records:

>d4ml8b1 d.145.1.0 (B:29-234) automated matches {Maize (Zea mays) [TaxId: 4577]}
dmlsplgalrldghfsfhdvsamardfgnqcsflpaavlhpgsvsdiaatvrhvfslgeg
spltvaarghghslmgqsqaaqgivvrmeslrgarlqvhdgfvdapggelwinvlretlk
hglapkswtdylhltvggtlsnagvsgqafrhgpqvsnvnqleivtgrgdvvtcspedns
dlfyaalgglgqfgiitrarialepa

Timeline for d4ml8b1:

• d4ml8b1 is new in SCOPe 2.05-stable
  
• d4ml8b1 appears in SCOPe 2.06
  
• d4ml8b1 appears in the current release, SCOPe 2.08