Lineage for d4ml8d1 (4ml8 D:29-234)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2223741Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2223742Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2223984Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 2223985Protein automated matches [191143] (10 species)
    not a true protein
  7. 2223990Species Maize (Zea mays) [TaxId:4577] [225479] (17 PDB entries)
  8. 2224012Domain d4ml8d1: 4ml8 D:29-234 [269670]
    Other proteins in same PDB: d4ml8a2, d4ml8b2, d4ml8c2, d4ml8d2
    automated match to d3s1da1
    complexed with fad, peg

Details for d4ml8d1

PDB Entry: 4ml8 (more details), 2.7 Å

PDB Description: structure of maize cytokinin oxidase/dehydrogenase 2 (zmcko2)
PDB Compounds: (D:) Cytokinin oxidase 2

SCOPe Domain Sequences for d4ml8d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ml8d1 d.145.1.0 (D:29-234) automated matches {Maize (Zea mays) [TaxId: 4577]}
dmlsplgalrldghfsfhdvsamardfgnqcsflpaavlhpgsvsdiaatvrhvfslgeg
spltvaarghghslmgqsqaaqgivvrmeslrgarlqvhdgfvdapggelwinvlretlk
hglapkswtdylhltvggtlsnagvsgqafrhgpqvsnvnqleivtgrgdvvtcspedns
dlfyaalgglgqfgiitrarialepa

SCOPe Domain Coordinates for d4ml8d1:

Click to download the PDB-style file with coordinates for d4ml8d1.
(The format of our PDB-style files is described here.)

Timeline for d4ml8d1: