Lineage for d1dbha2 (1dbh A:418-550)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 563841Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 563842Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 563843Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (30 proteins)
    Pfam 00169
  6. 563969Protein Son of sevenless-1 (sos-1) [50742] (2 species)
  7. 563970Species Human (Homo sapiens) [TaxId:9606] [50744] (4 PDB entries)
  8. 563971Domain d1dbha2: 1dbh A:418-550 [26967]
    Other proteins in same PDB: d1dbha1

Details for d1dbha2

PDB Entry: 1dbh (more details), 2.3 Å

PDB Description: dbl and pleckstrin homology domains from hsos1

SCOP Domain Sequences for d1dbha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens)}
aikkmneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccksnhgq
prlpgasnaeyrlkekffmrkvqindkddtneykhafeiilkdensvifsaksaeeknnw
maalislqyrstl

SCOP Domain Coordinates for d1dbha2:

Click to download the PDB-style file with coordinates for d1dbha2.
(The format of our PDB-style files is described here.)

Timeline for d1dbha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dbha1