SCOPe 2.07: Domain d4mh2f1: 4mh2 F:1-164

Lineage for d4mh2f1 (4mh2 F:1-164)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [269643] (2 PDB entries)

8. Domain d4mh2f1: 4mh2 F:1-164 [269667]
   Other proteins in same PDB: d4mh2b2, d4mh2d2, d4mh2f2, d4mh2i2
   automated match to d3sbcc_
   complexed with cit

Details for d4mh2f1

PDB Entry: 4mh2, 2.2 Å

PDB Description: crystal structure of bovine mitochondrial peroxiredoxin iii

PDB Compounds: (F:) Thioredoxin-dependent peroxide reductase, mitochondrial

SCOPe Domain Sequences for d4mh2f1:

Sequence; same for both SEQRES and ATOM records:

>d4mh2f1 c.47.1.0 (F:1-164) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkase
fhdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgl
alrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfveah

Timeline for d4mh2f1:

• d4mh2f1 first appeared in SCOPe 2.05, called d4mh2f_
  
• d4mh2f1 appears in SCOPe 2.06
  
• d4mh2f1 appears in the current release, SCOPe 2.08