Lineage for d4mh2d1 (4mh2 D:1-164)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879396Species Cow (Bos taurus) [TaxId:9913] [269643] (2 PDB entries)
  8. 2879400Domain d4mh2d1: 4mh2 D:1-164 [269661]
    Other proteins in same PDB: d4mh2b2, d4mh2d2, d4mh2f2, d4mh2i2
    automated match to d3sbcc_
    complexed with cit

Details for d4mh2d1

PDB Entry: 4mh2 (more details), 2.2 Å

PDB Description: crystal structure of bovine mitochondrial peroxiredoxin iii
PDB Compounds: (D:) Thioredoxin-dependent peroxide reductase, mitochondrial

SCOPe Domain Sequences for d4mh2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mh2d1 c.47.1.0 (D:1-164) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkase
fhdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgl
alrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfveah

SCOPe Domain Coordinates for d4mh2d1:

Click to download the PDB-style file with coordinates for d4mh2d1.
(The format of our PDB-style files is described here.)

Timeline for d4mh2d1: