Lineage for d1pms__ (1pms -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 563841Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 563842Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 563843Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (30 proteins)
    Pfam 00169
  6. 563969Protein Son of sevenless-1 (sos-1) [50742] (2 species)
  7. 563977Species Mouse (Mus musculus) [TaxId:10090] [50743] (1 PDB entry)
  8. 563978Domain d1pms__: 1pms - [26966]
    mutant

Details for d1pms__

PDB Entry: 1pms (more details)

PDB Description: pleckstrin homology domain of son of sevenless 1 (sos1) with glycine- serine added to the n-terminus, nmr, 20 structures

SCOP Domain Sequences for d1pms__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pms__ b.55.1.1 (-) Son of sevenless-1 (sos-1) {Mouse (Mus musculus)}
skqlaikkmneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccks
nhgqprlpgassaeyrlkekffmrkvqindkddtseykhafeiilkdgnsvifsaksaee
knnwmaalislqyrs

SCOP Domain Coordinates for d1pms__:

Click to download the PDB-style file with coordinates for d1pms__.
(The format of our PDB-style files is described here.)

Timeline for d1pms__: