Lineage for d1pms__ (1pms -)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.55: PH domain-like [50728] (1 superfamily) Superfamily b.55.1: PH domain-like [50729] (5 families) 
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (14 proteins) 
Protein Son of sevenless-1 (sos-1) [50742] (2 species) 
Species Mouse (Mus musculus) [TaxId:10090] [50743] (1 PDB entry) 
Domain d1pms__: 1pms - [26966]
Details for d1pms__
PDB Entry: 1pms (more details)
PDB Description: pleckstrin homology domain of son of sevenless 1 (sos1) with glycine- serine added to the n-terminus, nmr, 20 structures
SCOP Domain Sequences for d1pms__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pms__ b.55.1.1 (-) Son of sevenless-1 (sos-1) {Mouse (Mus musculus)}
skqlaikkmneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccks
nhgqprlpgassaeyrlkekffmrkvqindkddtseykhafeiilkdgnsvifsaksaee
knnwmaalislqyrs
SCOP Domain Coordinates for d1pms__:
Click to download the PDB-style file with coordinates for d1pms__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pms__:
- d1pms__ first appeared (with stable ids) in SCOP 1.55
- d1pms__ appears in SCOP 1.59
- d1pms__ appears in SCOP 1.63
- d1pms__ appears in the current release, SCOPe 2.08, called d1pmsa_
View in 3D