| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [269643] (2 PDB entries) |
| Domain d4mh2c_: 4mh2 C: [269659] Other proteins in same PDB: d4mh2b2, d4mh2d2, d4mh2f2, d4mh2i2 automated match to d3sbcc_ complexed with cit |
PDB Entry: 4mh2 (more details), 2.2 Å
SCOPe Domain Sequences for d4mh2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mh2c_ c.47.1.0 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasef
hdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgla
lrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfveahg
Timeline for d4mh2c_: