Lineage for d4mh3d_ (4mh3 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879396Species Cow (Bos taurus) [TaxId:9913] [269643] (2 PDB entries)
  8. 2879412Domain d4mh3d_: 4mh3 D: [269651]
    Other proteins in same PDB: d4mh3g2
    automated match to d3sbcc_
    complexed with cit, po4

Details for d4mh3d_

PDB Entry: 4mh3 (more details), 2.4 Å

PDB Description: crystal structure of bovine mitochondrial peroxiredoxin iii
PDB Compounds: (D:) Thioredoxin-dependent peroxide reductase, mitochondrial

SCOPe Domain Sequences for d4mh3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mh3d_ c.47.1.0 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasef
hdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgla
lrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfveahgevcp

SCOPe Domain Coordinates for d4mh3d_:

Click to download the PDB-style file with coordinates for d4mh3d_.
(The format of our PDB-style files is described here.)

Timeline for d4mh3d_: