Lineage for d1plsa_ (1pls A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1550802Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 1550937Protein Pleckstrin [50740] (1 species)
  7. 1550938Species Human (Homo sapiens) [TaxId:9606] [50741] (6 PDB entries)
  8. 1550946Domain d1plsa_: 1pls A: [26965]

Details for d1plsa_

PDB Entry: 1pls (more details)

PDB Description: solution structure of a pleckstrin homology domain
PDB Compounds: (A:) pleckstrin homology domain

SCOPe Domain Sequences for d1plsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
mepkriregylvkkgsvfntwkpmwvvlledgiefykkksdnspkgmiplkgstltspcq
dfgkrmfvfkitttkqqdhffqaafleerdawvrdinkaikcieglehhhhhh

SCOPe Domain Coordinates for d1plsa_:

Click to download the PDB-style file with coordinates for d1plsa_.
(The format of our PDB-style files is described here.)

Timeline for d1plsa_: