SCOPe 2.08: Domain d1plsa1: 1pls A:1-105

Lineage for d1plsa1 (1pls A:1-105)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Pleckstrin [50740] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50741] (6 PDB entries)

8. Domain d1plsa1: 1pls A:1-105 [26965]
   Other proteins in same PDB: d1plsa2

Details for d1plsa1

PDB Entry: 1pls

PDB Description: solution structure of a pleckstrin homology domain

PDB Compounds: (A:) pleckstrin homology domain

SCOPe Domain Sequences for d1plsa1:

Sequence; same for both SEQRES and ATOM records:

>d1plsa1 b.55.1.1 (A:1-105) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
mepkriregylvkkgsvfntwkpmwvvlledgiefykkksdnspkgmiplkgstltspcq
dfgkrmfvfkitttkqqdhffqaafleerdawvrdinkaikcieg

Timeline for d1plsa1:

• d1plsa1 first appeared (with stable ids) in SCOP 1.55, called d1pls__
  
• d1plsa1 appears in SCOPe 2.07