Lineage for d1plsa1 (1pls A:1-105)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394382Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 protein domains)
    Pfam PF00169
  6. 2394517Protein Pleckstrin [50740] (1 species)
  7. 2394518Species Human (Homo sapiens) [TaxId:9606] [50741] (6 PDB entries)
  8. 2394526Domain d1plsa1: 1pls A:1-105 [26965]
    Other proteins in same PDB: d1plsa2

Details for d1plsa1

PDB Entry: 1pls (more details)

PDB Description: solution structure of a pleckstrin homology domain
PDB Compounds: (A:) pleckstrin homology domain

SCOPe Domain Sequences for d1plsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1plsa1 b.55.1.1 (A:1-105) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
mepkriregylvkkgsvfntwkpmwvvlledgiefykkksdnspkgmiplkgstltspcq
dfgkrmfvfkitttkqqdhffqaafleerdawvrdinkaikcieg

SCOPe Domain Coordinates for d1plsa1:

Click to download the PDB-style file with coordinates for d1plsa1.
(The format of our PDB-style files is described here.)

Timeline for d1plsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1plsa2