Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [269643] (2 PDB entries) |
Domain d4mh3a_: 4mh3 A: [269645] Other proteins in same PDB: d4mh3g2 automated match to d3sbcc_ complexed with cit, po4 |
PDB Entry: 4mh3 (more details), 2.4 Å
SCOPe Domain Sequences for d4mh3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mh3a_ c.47.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} apavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkase fhdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgl alrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfveahge
Timeline for d4mh3a_: