![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins) this domain is inserted into a multihelical domain |
![]() | Protein vp6, the major capsid protein of group A rotavirus [63718] (2 species) |
![]() | Species Bovine rotavirus strain uk/g6 [TaxId:10934] [269641] (1 PDB entry) |
![]() | Domain d3j9sa2: 3j9s A:149-332 [269642] Other proteins in same PDB: d3j9sa1 automated match to d1qhda2 complexed with ca, cl, zn |
PDB Entry: 3j9s (more details), 2.6 Å
SCOPe Domain Sequences for d3j9sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3j9sa2 b.19.1.1 (A:149-332) vp6, the major capsid protein of group A rotavirus {Bovine rotavirus strain uk/g6 [TaxId: 10934]} gftfhkpnifpysasftlnrsqpahdnlmgtmwlnagseiqvagfdyscainapantqqf ehivqlrrvlttatitllpdaerfsfprvitsadgattwyfnpvilrpnnveiefllngq iintyqarfgtiiarnfdtirlsfqlmrppnmtpavaalfpnaqpfehhatvgltlries avce
Timeline for d3j9sa2: