Lineage for d3j9sa2 (3j9s A:149-332)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775475Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins)
    this domain is inserted into a multihelical domain
  6. 2775516Protein vp6, the major capsid protein of group A rotavirus [63718] (2 species)
  7. 2775517Species Bovine rotavirus strain uk/g6 [TaxId:10934] [269641] (1 PDB entry)
  8. 2775518Domain d3j9sa2: 3j9s A:149-332 [269642]
    Other proteins in same PDB: d3j9sa1
    automated match to d1qhda2
    complexed with ca, cl, zn

Details for d3j9sa2

PDB Entry: 3j9s (more details), 2.6 Å

PDB Description: single particle cryo-em structure of rotavirus vp6 at 2.6 angstrom resolution
PDB Compounds: (A:) Intermediate capsid protein VP6

SCOPe Domain Sequences for d3j9sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j9sa2 b.19.1.1 (A:149-332) vp6, the major capsid protein of group A rotavirus {Bovine rotavirus strain uk/g6 [TaxId: 10934]}
gftfhkpnifpysasftlnrsqpahdnlmgtmwlnagseiqvagfdyscainapantqqf
ehivqlrrvlttatitllpdaerfsfprvitsadgattwyfnpvilrpnnveiefllngq
iintyqarfgtiiarnfdtirlsfqlmrppnmtpavaalfpnaqpfehhatvgltlries
avce

SCOPe Domain Coordinates for d3j9sa2:

Click to download the PDB-style file with coordinates for d3j9sa2.
(The format of our PDB-style files is described here.)

Timeline for d3j9sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3j9sa1