Lineage for d3j9sa1 (3j9s A:1-148,A:333-397)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725196Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
    multihelical; three-helical bundle in the core is surrounded by non-conserved helices
  4. 2725197Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families) (S)
    this domain is interrupted by a jelly-roll beta-sandwich domain
  5. 2725220Family a.115.1.2: vp6, the major capsid protein of group A rotavirus [63596] (1 protein)
  6. 2725221Protein vp6, the major capsid protein of group A rotavirus [63597] (2 species)
  7. 2725222Species Bovine rotavirus strain uk/g6 [TaxId:10934] [269639] (1 PDB entry)
  8. 2725223Domain d3j9sa1: 3j9s A:1-148,A:333-397 [269640]
    Other proteins in same PDB: d3j9sa2
    automated match to d1qhda1
    complexed with ca, cl, zn

Details for d3j9sa1

PDB Entry: 3j9s (more details), 2.6 Å

PDB Description: single particle cryo-em structure of rotavirus vp6 at 2.6 angstrom resolution
PDB Compounds: (A:) Intermediate capsid protein VP6

SCOPe Domain Sequences for d3j9sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j9sa1 a.115.1.2 (A:1-148,A:333-397) vp6, the major capsid protein of group A rotavirus {Bovine rotavirus strain uk/g6 [TaxId: 10934]}
mdvlyslsktlkdardkivegtlysnvsdliqqfnqmiitmngnefqtggignlpirnwn
fdfgllgttllnldanyvetarntidyfvdfvdnvcmdemvresqrngiapqsdslikls
gikfkrinfdnsseyienwnlqnrrqrtXsvladasetmlanvtsvrqeyaipvgpvfpp
gmnwtdlitnyspsrednlqrvftvasirsmlvk

SCOPe Domain Coordinates for d3j9sa1:

Click to download the PDB-style file with coordinates for d3j9sa1.
(The format of our PDB-style files is described here.)

Timeline for d3j9sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3j9sa2