SCOPe 2.08: Domain d3j9sa1: 3j9s A:1-148,A:333-397

Lineage for d3j9sa1 (3j9s A:1-148,A:333-397)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
   multihelical; three-helical bundle in the core is surrounded by non-conserved helices

4. Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families)
   this domain is interrupted by a jelly-roll beta-sandwich domain

5. Family a.115.1.2: vp6, the major capsid protein of group A rotavirus [63596] (1 protein)

6. Protein vp6, the major capsid protein of group A rotavirus [63597] (2 species)

7. Species Bovine rotavirus strain uk/g6 [TaxId:10934] [269639] (1 PDB entry)

8. Domain d3j9sa1: 3j9s A:1-148,A:333-397 [269640]
   Other proteins in same PDB: d3j9sa2
   automated match to d1qhda1
   complexed with ca, cl, zn

Details for d3j9sa1

PDB Entry: 3j9s, 2.6 Å

PDB Description: single particle cryo-em structure of rotavirus vp6 at 2.6 angstrom resolution

PDB Compounds: (A:) Intermediate capsid protein VP6

SCOPe Domain Sequences for d3j9sa1:

Sequence; same for both SEQRES and ATOM records:

>d3j9sa1 a.115.1.2 (A:1-148,A:333-397) vp6, the major capsid protein of group A rotavirus {Bovine rotavirus strain uk/g6 [TaxId: 10934]}
mdvlyslsktlkdardkivegtlysnvsdliqqfnqmiitmngnefqtggignlpirnwn
fdfgllgttllnldanyvetarntidyfvdfvdnvcmdemvresqrngiapqsdslikls
gikfkrinfdnsseyienwnlqnrrqrtXsvladasetmlanvtsvrqeyaipvgpvfpp
gmnwtdlitnyspsrednlqrvftvasirsmlvk

Timeline for d3j9sa1:

• d3j9sa1 first appeared in SCOPe 2.05
  
• d3j9sa1 appears in SCOPe 2.07