Lineage for d1b55b_ (1b55 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61845Fold b.55: PH domain-like [50728] (1 superfamily)
  4. 61846Superfamily b.55.1: PH domain-like [50729] (5 families) (S)
  5. 61847Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (11 proteins)
  6. 61854Protein Bruton's tyrosine kinase [50738] (1 species)
  7. 61855Species Human (Homo sapiens) [TaxId:9606] [50739] (3 PDB entries)
  8. 61861Domain d1b55b_: 1b55 B: [26964]

Details for d1b55b_

PDB Entry: 1b55 (more details), 2.4 Å

PDB Description: ph domain from bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate

SCOP Domain Sequences for d1b55b_:

Sequence, based on SEQRES records: (download)

>d1b55b_ b.55.1.1 (B:) Bruton's tyrosine kinase {Human (Homo sapiens)}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

Sequence, based on observed residues (ATOM records): (download)

>d1b55b_ b.55.1.1 (B:) Bruton's tyrosine kinase {Human (Homo sapiens)}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqisemeqisiierfpypfqvvydegplyvfspteelrkrwihql
knvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

SCOP Domain Coordinates for d1b55b_:

Click to download the PDB-style file with coordinates for d1b55b_.
(The format of our PDB-style files is described here.)

Timeline for d1b55b_: