Lineage for d3j9ca1 (3j9c A:174-225)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825681Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2825682Superfamily b.179.1: PA14-like [254123] (4 families) (S)
  5. 2825683Family b.179.1.1: PA14 [254147] (2 proteins)
    Pfam PF07691
  6. 2825694Protein PA14 [254334] (1 species)
  7. 2825695Species Bacillus anthracis [254763] (15 PDB entries)
  8. 2825709Domain d3j9ca1: 3j9c A:174-225 [269638]
    automated match to d1tzoa2
    complexed with ca
    fragment; missing more than one-third of the common structure and/or sequence

Details for d3j9ca1

PDB Entry: 3j9c (more details), 2.9 Å

PDB Description: cryoem single particle reconstruction of anthrax toxin protective antigen pore at 2.9 angstrom resolution
PDB Compounds: (A:) Protective antigen PA-63

SCOPe Domain Sequences for d3j9ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j9ca1 b.179.1.1 (A:174-225) PA14 {Bacillus anthracis}
tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspek

SCOPe Domain Coordinates for d3j9ca1:

Click to download the PDB-style file with coordinates for d3j9ca1.
(The format of our PDB-style files is described here.)

Timeline for d3j9ca1: