Lineage for d4d46b_ (4d46 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091795Protein automated matches [190085] (51 species)
    not a true protein
  7. 2091923Species Escherichia coli [TaxId:469008] [256724] (3 PDB entries)
  8. 2091929Domain d4d46b_: 4d46 B: [269637]
    automated match to d1qg6a_
    complexed with j47, nad

Details for d4d46b_

PDB Entry: 4d46 (more details), 2 Å

PDB Description: crystal structure of e. coli fabi in complex with nad and 5- bromo-2-(4-chloro-2-hydroxyphenoxy)benzonitrile
PDB Compounds: (B:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d4d46b_:

Sequence, based on SEQRES records: (download)

>d4d46b_ c.2.1.2 (B:) automated matches {Escherichia coli [TaxId: 469008]}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
gevvhvdggfsiaam

Sequence, based on observed residues (ATOM records): (download)

>d4d46b_ c.2.1.2 (B:) automated matches {Escherichia coli [TaxId: 469008]}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtlaasgikdfceavtpirrtvtiedvgnsaaflcsdlsagisgevvhv
dggfsiaam

SCOPe Domain Coordinates for d4d46b_:

Click to download the PDB-style file with coordinates for d4d46b_.
(The format of our PDB-style files is described here.)

Timeline for d4d46b_: