SCOP 1.65: Domain d1b55a_: 1b55 A:

Lineage for d1b55a_ (1b55 A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (6 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (15 proteins)

6. Protein Bruton's tyrosine kinase [50738] (1 species)
   contains Btk zinc-binding motif

7. Species Human (Homo sapiens) [TaxId:9606] [50739] (3 PDB entries)

8. Domain d1b55a_: 1b55 A: [26963]

Details for d1b55a_

PDB Entry: 1b55, 2.4 Å

PDB Description: ph domain from bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate

SCOP Domain Sequences for d1b55a_:

Sequence, based on SEQRES records:

>d1b55a_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens)}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

Sequence, based on observed residues (ATOM records):

>d1b55a_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens)}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqiprrmeqisiierfpypfqvvydegplyvfspteelrkrwihq
lknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

Timeline for d1b55a_:

• d1b55a_ first appeared (with stable ids) in SCOP 1.55
  
• d1b55a_ appears in SCOP 1.63
  
• d1b55a_ appears in SCOP 1.67
  
• d1b55a_ appears in the current release, SCOPe 2.08