Class b: All beta proteins [48724] (177 folds) |
Fold b.159: AOC barrel-like [141492] (2 superfamilies) barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds |
Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families) |
Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins) Pfam PF06351 |
Protein automated matches [190385] (2 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187238] (3 PDB entries) |
Domain d4cq6b_: 4cq6 B: [269629] automated match to d2brja1 complexed with mrd, po4, t25 |
PDB Entry: 4cq6 (more details), 1.8 Å
SCOPe Domain Sequences for d4cq6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cq6b_ b.159.1.1 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
Timeline for d4cq6b_: