Lineage for d4cq6b_ (4cq6 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089274Fold b.159: AOC barrel-like [141492] (2 superfamilies)
    barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds
  4. 2089275Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families) (S)
  5. 2089276Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins)
    Pfam PF06351
  6. 2089297Protein automated matches [190385] (2 species)
    not a true protein
  7. 2089323Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187238] (3 PDB entries)
  8. 2089330Domain d4cq6b_: 4cq6 B: [269629]
    automated match to d2brja1
    complexed with mrd, po4, t25

Details for d4cq6b_

PDB Entry: 4cq6 (more details), 1.8 Å

PDB Description: the crystal structure of the allene oxide cyclase 2 from arabidopsis thaliana with bound inhibitor - vernolic acid
PDB Compounds: (B:) allene oxide cyclase 2, chloroplastic

SCOPe Domain Sequences for d4cq6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cq6b_ b.159.1.1 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn

SCOPe Domain Coordinates for d4cq6b_:

Click to download the PDB-style file with coordinates for d4cq6b_.
(The format of our PDB-style files is described here.)

Timeline for d4cq6b_: