SCOPe 2.07: Domain d4cjnb2: 4cjn B:139-327

Lineage for d4cjnb2 (4cjn B:139-327)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (13 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [256156] (6 PDB entries)

8. Domain d4cjnb2: 4cjn B:139-327 [269621]
   Other proteins in same PDB: d4cjna1, d4cjna3, d4cjnb1, d4cjnb3
   automated match to d1vqqa2
   complexed with cd, cl, mur, qnz

Details for d4cjnb2

PDB Entry: 4cjn, 1.95 Å

PDB Description: crystal structure of pbp2a from mrsa in complex with quinazolinone ligand

PDB Compounds: (B:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d4cjnb2:

Sequence; same for both SEQRES and ATOM records:

>d4cjnb2 d.175.1.0 (B:139-327) automated matches {Staphylococcus aureus [TaxId: 158878]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Timeline for d4cjnb2:

• d4cjnb2 first appeared in SCOPe 2.05
  
• d4cjnb2 appears in SCOPe 2.06
  
• d4cjnb2 appears in the current release, SCOPe 2.08