SCOP 1.67: Domain d1bwnb_: 1bwn B:

Lineage for d1bwnb_ (1bwn B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (8 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (15 proteins)

6. Protein Bruton's tyrosine kinase [50738] (1 species)
   contains Btk zinc-binding motif

7. Species Human (Homo sapiens) [TaxId:9606] [50739] (3 PDB entries)

8. Domain d1bwnb_: 1bwn B: [26962]
   complexed with 4ip, zn; mutant

Details for d1bwnb_

PDB Entry: 1bwn, 2.1 Å

PDB Description: ph domain and btk motif from bruton's tyrosine kinase mutant e41k in complex with ins(1,3,4,5)p4

SCOP Domain Sequences for d1bwnb_:

Sequence, based on SEQRES records:

>d1bwnb_ b.55.1.1 (B:) Bruton's tyrosine kinase {Human (Homo sapiens)}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyykydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

Sequence, based on observed residues (ATOM records):

>d1bwnb_ b.55.1.1 (B:) Bruton's tyrosine kinase {Human (Homo sapiens)}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyykydfergrrgskkgsidveki
tcvetvvpeknppperqiemeqisiierfpypfqvvydegplyvfspteelrkrwihqlk
nvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

Timeline for d1bwnb_:

• d1bwnb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bwnb_ appears in SCOP 1.65
  
• d1bwnb_ appears in SCOP 1.69
  
• d1bwnb_ appears in the current release, SCOPe 2.08