Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein automated matches [226905] (13 species) not a true protein |
Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [269617] (2 PDB entries) |
Domain d4ci6a2: 4ci6 A:147-374 [269618] Other proteins in same PDB: d4ci6a1 automated match to d3ub5a2 complexed with atp, ca |
PDB Entry: 4ci6 (more details), 2.65 Å
SCOPe Domain Sequences for d4ci6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ci6a2 c.55.1.1 (A:147-374) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} rttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmkiltergysftttaer eivrdikeklcyvaldfeqemataaastsleksyelpdgqviaignerfrcpealfqpsf lgmescgihetvynsimkcdvdirkdlyantvmsggttmypgiadrmqkeitalapstik tkiiapperkysvwiggsilaslstfqqmwiskeeydesgpgivhrkc
Timeline for d4ci6a2: