Lineage for d1bwna_ (1bwn A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16243Fold b.55: PH domain-like [50728] (1 superfamily)
  4. 16244Superfamily b.55.1: PH domain-like [50729] (5 families) (S)
  5. 16245Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (11 proteins)
  6. 16252Protein Bruton's tyrosine kinase [50738] (1 species)
  7. 16253Species Human (Homo sapiens) [TaxId:9606] [50739] (3 PDB entries)
  8. 16256Domain d1bwna_: 1bwn A: [26961]

Details for d1bwna_

PDB Entry: 1bwn (more details), 2.1 Å

PDB Description: ph domain and btk motif from bruton's tyrosine kinase mutant e41k in complex with ins(1,3,4,5)p4

SCOP Domain Sequences for d1bwna_:

Sequence, based on SEQRES records: (download)

>d1bwna_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens)}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyykydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

Sequence, based on observed residues (ATOM records): (download)

>d1bwna_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens)}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyykydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgsemeqisiierfpypfqvvydegplyvfspteelrkrw
ihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

SCOP Domain Coordinates for d1bwna_:

Click to download the PDB-style file with coordinates for d1bwna_.
(The format of our PDB-style files is described here.)

Timeline for d1bwna_: