SCOPe 2.08: Domain d1bwna_: 1bwn A:

Lineage for d1bwna_ (1bwn A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Bruton's tyrosine kinase [50738] (1 species)
   contains Btk zinc-binding motif

7. Species Human (Homo sapiens) [TaxId:9606] [50739] (10 PDB entries)

8. Domain d1bwna_: 1bwn A: [26961]
   complexed with 4ip, zn; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d1bwna_

PDB Entry: 1bwn, 2.1 Å

PDB Description: ph domain and btk motif from bruton's tyrosine kinase mutant e41k in complex with ins(1,3,4,5)p4

PDB Compounds: (A:) bruton's tyrosine kinase

SCOPe Domain Sequences for d1bwna_:

Sequence, based on SEQRES records:

>d1bwna_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyykydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

Sequence, based on observed residues (ATOM records):

>d1bwna_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
aavilesiflkrsqqkkktsplnfkkrlflltvhklsyykydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgsemeqisiierfpypfqvvydegplyvfspteelrkrw
ihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

Timeline for d1bwna_:

• d1bwna_ first appeared (with stable ids) in SCOP 1.55
  
• d1bwna_ appears in SCOPe 2.07