SCOPe 2.06: Domain d5aena2: 5aen A:209-460

Lineage for d5aena2 (5aen A:209-460)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
   adopts thermolysin-like fold

6. Protein automated matches [269605] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [269606] (4 PDB entries)

8. Domain d5aena2: 5aen A:209-460 [269607]
   Other proteins in same PDB: d5aena1, d5aena3
   automated match to d3u9wa2
   complexed with dp8, imd, yb, zn

Details for d5aena2

PDB Entry: 5aen, 1.86 Å

PDB Description: structure of human leukotriene a4 hydrolase in complex with inhibitor dimethyl(2- (4-phenoxyphenoxy)ethyl)amine

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d5aena2:

Sequence; same for both SEQRES and ATOM records:

>d5aena2 d.92.1.13 (A:209-460) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

Timeline for d5aena2:

• d5aena2 first appeared in SCOPe 2.05
  
• d5aena2 appears in SCOPe 2.07
  
• d5aena2 appears in the current release, SCOPe 2.08