Lineage for d1btkb_ (1btk B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378166Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 378167Superfamily b.55.1: PH domain-like [50729] (8 families) (S)
  5. 378168Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (15 proteins)
  6. 378175Protein Bruton's tyrosine kinase [50738] (1 species)
    contains Btk zinc-binding motif
  7. 378176Species Human (Homo sapiens) [TaxId:9606] [50739] (3 PDB entries)
  8. 378178Domain d1btkb_: 1btk B: [26960]
    complexed with na, zn; mutant

Details for d1btkb_

PDB Entry: 1btk (more details), 1.6 Å

PDB Description: ph domain and btk motif from bruton's tyrosine kinase mutant r28c

SCOP Domain Sequences for d1btkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1btkb_ b.55.1.1 (B:) Bruton's tyrosine kinase {Human (Homo sapiens)}
aavilesiflkrsqqkkktsplnfkkclflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

SCOP Domain Coordinates for d1btkb_:

Click to download the PDB-style file with coordinates for d1btkb_.
(The format of our PDB-style files is described here.)

Timeline for d1btkb_: