SCOP 1.63: Domain d1btkb_: 1btk B:

Lineage for d1btkb_ (1btk B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (6 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (14 proteins)

6. Protein Bruton's tyrosine kinase [50738] (1 species)
   contains Btk zinc-binding motif

7. Species Human (Homo sapiens) [TaxId:9606] [50739] (3 PDB entries)

8. Domain d1btkb_: 1btk B: [26960]
   complexed with na, zn; mutant

Details for d1btkb_

PDB Entry: 1btk, 1.6 Å

PDB Description: ph domain and btk motif from bruton's tyrosine kinase mutant r28c

SCOP Domain Sequences for d1btkb_:

Sequence; same for both SEQRES and ATOM records:

>d1btkb_ b.55.1.1 (B:) Bruton's tyrosine kinase {Human (Homo sapiens)}
aavilesiflkrsqqkkktsplnfkkclflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

Timeline for d1btkb_:

• d1btkb_ first appeared (with stable ids) in SCOP 1.55
  
• d1btkb_ appears in SCOP 1.61
  
• d1btkb_ appears in SCOP 1.65
  
• d1btkb_ appears in the current release, SCOPe 2.08