SCOPe 2.05: Domain d4xxvb_: 4xxv B:

Lineage for d4xxvb_ (4xxv B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.0: automated matches [191423] (1 protein)
   not a true family

6. Protein automated matches [190603] (14 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [269591] (1 PDB entry)

8. Domain d4xxvb_: 4xxv B: [269593]
   automated match to d1cnza_
   complexed with gol, nad

Details for d4xxvb_

PDB Entry: 4xxv, 1.7 Å

PDB Description: Crystal structure of 3-isopropylmalate dehydrogenase from Burkholderia thailandensis in complex with NAD

PDB Compounds: (B:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d4xxvb_:

Sequence; same for both SEQRES and ATOM records:

>d4xxvb_ c.77.1.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mkiavlpgdgigpeivneavkvlnaldekfelehapvggagyeasghplpdatlalakea
dailfgavgdwkydsleralrpeqailglrkhlelfanfrpaicypqlvdasplkpelva
gldilivrelngdiyfgqprgvraapdgpfageregfdtmrysepevrriahvafqaaqk
rakkllsvdksnvletsqfwrdvmidvskeyadvelshmyvdnaamqlakapkqfdvivt
gnmfgdilsdeasmltgsigmlpsasldknnkglyepshgsapdiagkgianplatilsa
amllryslnraeqadrieravktvleqgyrtgdiatpgcrqvgtaamgdavvaal

Timeline for d4xxvb_:

• d4xxvb_ is new in SCOPe 2.05-stable
  
• d4xxvb_ appears in SCOPe 2.06
  
• d4xxvb_ appears in the current release, SCOPe 2.08