Lineage for d4xxva_ (4xxv A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1873551Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1873552Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1873882Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 1873883Protein automated matches [190603] (14 species)
    not a true protein
  7. 1873911Species Burkholderia thailandensis [TaxId:271848] [269591] (1 PDB entry)
  8. 1873912Domain d4xxva_: 4xxv A: [269592]
    automated match to d1cnza_
    complexed with gol, nad

Details for d4xxva_

PDB Entry: 4xxv (more details), 1.7 Å

PDB Description: Crystal structure of 3-isopropylmalate dehydrogenase from Burkholderia thailandensis in complex with NAD
PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d4xxva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xxva_ c.77.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
hmkiavlpgdgigpeivneavkvlnaldekfelehapvggagyeasghplpdatlalake
adailfgavgdwkydsleralrpeqailglrkhlelfanfrpaicypqlvdasplkpelv
agldilivrelngdiyfgqprgvraapdgpfageregfdtmrysepevrriahvafqaaq
krakkllsvdksnvletsqfwrdvmidvskeyadvelshmyvdnaamqlakapkqfdviv
tgnmfgdilsdeasmltgsigmlpsasldknnkglyepshgsapdiagkgianplatils
aamllryslnraeqadrieravktvleqgyrtgdiatpgcrqvgtaamgdavvaal

SCOPe Domain Coordinates for d4xxva_:

Click to download the PDB-style file with coordinates for d4xxva_.
(The format of our PDB-style files is described here.)

Timeline for d4xxva_: