![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families) ![]() automatically mapped to Pfam PF08527 |
![]() | Family b.2.9.1: Peptidylarginine deiminase Pad4, middle domain [110084] (1 protein) |
![]() | Protein Peptidylarginine deiminase Pad4, middle domain [110085] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110086] (17 PDB entries) Uniprot Q9UM07 |
![]() | Domain d4x8ca1: 4x8c A:113-293 [269586] Other proteins in same PDB: d4x8ca2 automated match to d2dexx1 complexed with 3yz, ca |
PDB Entry: 4x8c (more details), 3.1 Å
SCOPe Domain Sequences for d4x8ca1:
Sequence, based on SEQRES records: (download)
>d4x8ca1 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]} veislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevl dsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpk wpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfr v
>d4x8ca1 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]} veislcaditrtgkvkpkdqrtwtwgpcgqgaillvncdsedlqdmslmtlstktpkdff tnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpkwpshylmvpggkhnmdfyveal afpdtdfpglitltislldtsnlelpeavvfqdsvvfrv
Timeline for d4x8ca1: