| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d4x6bc2: 4x6b C:114-202 [269583] Other proteins in same PDB: d4x6ba1, d4x6bb1, d4x6bb2, d4x6bc1, d4x6bd1, d4x6bd2 automated match to d2pyfa2 |
PDB Entry: 4x6b (more details), 2.1 Å
SCOPe Domain Sequences for d4x6bc2:
Sequence, based on SEQRES records: (download)
>d4x6bc2 b.1.1.2 (C:114-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps
>d4x6bc2 b.1.1.2 (C:114-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsvclftdfdsqtnvsqskdsdvyitdkcvldmsnsavawsdfacana
fnnsiipedtffps
Timeline for d4x6bc2: