Lineage for d4x6ba2 (4x6b A:114-202)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750885Domain d4x6ba2: 4x6b A:114-202 [269579]
    Other proteins in same PDB: d4x6ba1, d4x6bb1, d4x6bb2, d4x6bc1, d4x6bd1, d4x6bd2
    automated match to d2pyfa2

Details for d4x6ba2

PDB Entry: 4x6b (more details), 2.1 Å

PDB Description: bk6 tcr apo structure
PDB Compounds: (A:) tcr alpha

SCOPe Domain Sequences for d4x6ba2:

Sequence, based on SEQRES records: (download)

>d4x6ba2 b.1.1.2 (A:114-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d4x6ba2 b.1.1.2 (A:114-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
nksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d4x6ba2:

Click to download the PDB-style file with coordinates for d4x6ba2.
(The format of our PDB-style files is described here.)

Timeline for d4x6ba2: