Lineage for d4x6na_ (4x6n A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795278Protein Coagulation factor XI [117237] (1 species)
  7. 2795279Species Human (Homo sapiens) [TaxId:9606] [117238] (59 PDB entries)
    Uniprot P03951 388-624
  8. 2795327Domain d4x6na_: 4x6n A: [269577]
    automated match to d4ty6a_
    complexed with 3y5, edo, so4

Details for d4x6na_

PDB Entry: 4x6n (more details), 2.1 Å

PDB Description: factor xia in complex with the inhibitor 1-{(1s)-1-[4-(3-amino-1h- indazol-6-yl)-5-chloro-1h-imidazol-2-yl]-2-phenylethyl}-3-[5-chloro- 2-(1h-tetrazol-1-yl)benzyl]urea
PDB Compounds: (A:) coagulation factor xi, light chain

SCOPe Domain Sequences for d4x6na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x6na_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvgygdsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d4x6na_:

Click to download the PDB-style file with coordinates for d4x6na_.
(The format of our PDB-style files is described here.)

Timeline for d4x6na_: