Lineage for d4x6oa_ (4x6o A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795550Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 1795551Protein automated matches [190438] (20 species)
    not a true protein
  7. 1795573Species Human (Homo sapiens) [TaxId:9606] [187421] (52 PDB entries)
  8. 1795598Domain d4x6oa_: 4x6o A: [269576]
    automated match to d1p57b_
    complexed with 3y4, edo, so4

Details for d4x6oa_

PDB Entry: 4x6o (more details), 2.1 Å

PDB Description: factor xia in complex with the inhibitor methyl (4-{4-chloro-2-[(1s)- 1-({3-[5-chloro-2-(1h-tetrazol-1-yl)phenyl]propanoyl}amino)-2- phenylethyl]-1h-imidazol-5-yl}phenyl)carbamate
PDB Compounds: (A:) coagulation factor xi, light chain

SCOPe Domain Sequences for d4x6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x6oa_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvgygdsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d4x6oa_:

Click to download the PDB-style file with coordinates for d4x6oa_.
(The format of our PDB-style files is described here.)

Timeline for d4x6oa_: