SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4x6cf2 (4x6c F:117-243)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (24 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (786 PDB entries)
  8. 2028177Domain d4x6cf2: 4x6c F:117-243 [269575]
    Other proteins in same PDB: d4x6ca1, d4x6ca2, d4x6cb_, d4x6cc1, d4x6cd_, d4x6ce2, d4x6cg2
    automated match to d2nw2b2
    complexed with 42h, nag

Details for d4x6cf2

PDB Entry: 4x6c (more details), 2.8 Å

PDB Description: cd1a ternary complex with lysophosphatidylcholine and bk6 tcr
PDB Compounds: (F:) tcr beta

SCOPe Domain Sequences for d4x6cf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x6cf2 b.1.1.0 (F:117-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlnkvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgr

SCOPe Domain Coordinates for d4x6cf2:

Click to download the PDB-style file with coordinates for d4x6cf2.
(The format of our PDB-style files is described here.)

Timeline for d4x6cf2: