Lineage for d4x6cf1 (4x6c F:1-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757507Domain d4x6cf1: 4x6c F:1-116 [269574]
    Other proteins in same PDB: d4x6ca1, d4x6ca2, d4x6cb_, d4x6cc1, d4x6cd_, d4x6ce2, d4x6cg2
    automated match to d2nw2b1
    complexed with 42h, nag

Details for d4x6cf1

PDB Entry: 4x6c (more details), 2.8 Å

PDB Description: cd1a ternary complex with lysophosphatidylcholine and bk6 tcr
PDB Compounds: (F:) tcr beta

SCOPe Domain Sequences for d4x6cf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x6cf1 b.1.1.0 (F:1-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nagvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgev
pdgynvsrlkkqnfllglesaapsqtsvyfcasryflptqgmgaffgqgtrltvve

SCOPe Domain Coordinates for d4x6cf1:

Click to download the PDB-style file with coordinates for d4x6cf1.
(The format of our PDB-style files is described here.)

Timeline for d4x6cf1: