SCOPe 2.08: Domain d4x6ce2: 4x6c E:114-202

Lineage for d4x6ce2 (4x6c E:114-202)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4x6ce2: 4x6c E:114-202 [269569]
   Other proteins in same PDB: d4x6ca1, d4x6ca2, d4x6cb_, d4x6cc1, d4x6cd_, d4x6ce1, d4x6cf1, d4x6cf2, d4x6cg1, d4x6ch1, d4x6ch2
   automated match to d2pyfa2
   complexed with 42h, nag

Details for d4x6ce2

PDB Entry: 4x6c, 2.8 Å

PDB Description: cd1a ternary complex with lysophosphatidylcholine and bk6 tcr

PDB Compounds: (E:) tcr alpha

SCOPe Domain Sequences for d4x6ce2:

Sequence, based on SEQRES records:

>d4x6ce2 b.1.1.2 (E:114-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d4x6ce2 b.1.1.2 (E:114-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrddksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
snksdfacanafnnsiipedtffps

Timeline for d4x6ce2:

• d4x6ce2 first appeared in SCOPe 2.05
  
• d4x6ce2 appears in SCOPe 2.07