SCOPe 2.07: Domain d4x6dh1: 4x6d H:3-116

Lineage for d4x6dh1 (4x6d H:3-116)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4x6dh1: 4x6d H:3-116 [269566]
   Other proteins in same PDB: d4x6da1, d4x6da2, d4x6db_, d4x6dc1, d4x6dd_, d4x6de2, d4x6dg2
   automated match to d2nw2b1
   complexed with ola, pam

Details for d4x6dh1

PDB Entry: 4x6d, 2.98 Å

PDB Description: cd1a ternary complex with endogenous lipids and bk6 tcr

PDB Compounds: (H:) tcr beta

SCOPe Domain Sequences for d4x6dh1:

Sequence; same for both SEQRES and ATOM records:

>d4x6dh1 b.1.1.0 (H:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgevpd
gynvsrlkkqnfllglesaapsqtsvyfcasryflptqgmgaffgqgtrltvve

Timeline for d4x6dh1:

• d4x6dh1 first appeared in SCOPe 2.05
  
• d4x6dh1 appears in SCOPe 2.06
  
• d4x6dh1 appears in the current release, SCOPe 2.08