Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d4x6dh1: 4x6d H:3-116 [269566] Other proteins in same PDB: d4x6da1, d4x6da2, d4x6db_, d4x6dc1, d4x6dd_, d4x6de2, d4x6dg2 automated match to d2nw2b1 complexed with ola, pam |
PDB Entry: 4x6d (more details), 2.98 Å
SCOPe Domain Sequences for d4x6dh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x6dh1 b.1.1.0 (H:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgevpd gynvsrlkkqnfllglesaapsqtsvyfcasryflptqgmgaffgqgtrltvve
Timeline for d4x6dh1: