Lineage for d4x6dh1 (4x6d H:3-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758104Domain d4x6dh1: 4x6d H:3-116 [269566]
    Other proteins in same PDB: d4x6da1, d4x6da2, d4x6db_, d4x6dc1, d4x6dd_, d4x6de2, d4x6dg2
    automated match to d2nw2b1
    complexed with ola, pam

Details for d4x6dh1

PDB Entry: 4x6d (more details), 2.98 Å

PDB Description: cd1a ternary complex with endogenous lipids and bk6 tcr
PDB Compounds: (H:) tcr beta

SCOPe Domain Sequences for d4x6dh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x6dh1 b.1.1.0 (H:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgevpd
gynvsrlkkqnfllglesaapsqtsvyfcasryflptqgmgaffgqgtrltvve

SCOPe Domain Coordinates for d4x6dh1:

Click to download the PDB-style file with coordinates for d4x6dh1.
(The format of our PDB-style files is described here.)

Timeline for d4x6dh1: