SCOPe 2.08: Domain d4x6dg2: 4x6d G:114-201

Lineage for d4x6dg2 (4x6d G:114-201)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4x6dg2: 4x6d G:114-201 [269563]
   Other proteins in same PDB: d4x6da1, d4x6da2, d4x6db_, d4x6dc1, d4x6dd_, d4x6de1, d4x6df1, d4x6df2, d4x6dg1, d4x6dh1, d4x6dh2
   automated match to d2pyfa2
   complexed with ola, pam

Details for d4x6dg2

PDB Entry: 4x6d, 2.98 Å

PDB Description: cd1a ternary complex with endogenous lipids and bk6 tcr

PDB Compounds: (G:) tcr alpha

SCOPe Domain Sequences for d4x6dg2:

Sequence; same for both SEQRES and ATOM records:

>d4x6dg2 b.1.1.2 (G:114-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Timeline for d4x6dg2:

• d4x6dg2 first appeared in SCOPe 2.05
  
• d4x6dg2 appears in SCOPe 2.07