Lineage for d4x6cc1 (4x6c C:7-183)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182598Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2182622Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (10 PDB entries)
  8. 2182633Domain d4x6cc1: 4x6c C:7-183 [269553]
    Other proteins in same PDB: d4x6ca2, d4x6cb_, d4x6cd_, d4x6ce1, d4x6ce2, d4x6cf1, d4x6cf2, d4x6cg1, d4x6cg2, d4x6ch1, d4x6ch2
    automated match to d3t8xc1
    complexed with 42h, nag

Details for d4x6cc1

PDB Entry: 4x6c (more details), 2.8 Å

PDB Description: cd1a ternary complex with lysophosphatidylcholine and bk6 tcr
PDB Compounds: (C:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d4x6cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x6cc1 d.19.1.1 (C:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel
etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf
qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

SCOPe Domain Coordinates for d4x6cc1:

Click to download the PDB-style file with coordinates for d4x6cc1.
(The format of our PDB-style files is described here.)

Timeline for d4x6cc1: