SCOPe 2.08: Domain d4x6ea1: 4x6e A:7-183

Lineage for d4x6ea1 (4x6e A:7-183)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (17 PDB entries)

8. Domain d4x6ea1: 4x6e A:7-183 [269547]
   Other proteins in same PDB: d4x6ea2, d4x6ea3, d4x6eb_
   automated match to d3t8xc1
   complexed with 42h, mlt

Details for d4x6ea1

PDB Entry: 4x6e, 2.1 Å

PDB Description: cd1a binary complex with lysophosphatidylcholine

PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d4x6ea1:

Sequence, based on SEQRES records:

>d4x6ea1 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel
etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf
qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

Sequence, based on observed residues (ATOM records):

>d4x6ea1 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
plsfhviwiasfkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkeletlfr
irtirsfegirryahelqfeypfeiqvtggcegsflqlayqgsdfvsfqnnswlpypvag
nmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

Timeline for d4x6ea1:

• d4x6ea1 first appeared in SCOPe 2.05
  
• d4x6ea1 appears in SCOPe 2.07