SCOPe 2.08: Domain d4x6fa2: 4x6f A:184-278

Lineage for d4x6fa2 (4x6f A:184-278)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein CD1, alpha-3 domain [88615] (5 species)

7. Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (10 PDB entries)

8. Domain d4x6fa2: 4x6f A:184-278 [269546]
   Other proteins in same PDB: d4x6fa1, d4x6fa3, d4x6fb_
   automated match to d3t8xc2
   complexed with 3xu

Details for d4x6fa2

PDB Entry: 4x6f, 1.91 Å

PDB Description: cd1a binary complex with sphingomyelin

PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d4x6fa2:

Sequence; same for both SEQRES and ATOM records:

>d4x6fa2 b.1.1.2 (A:184-278) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]}
qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw
ylratlevaageaadlscrvkhsslegqdivlywe

Timeline for d4x6fa2:

• d4x6fa2 first appeared in SCOPe 2.05
  
• d4x6fa2 appears in SCOPe 2.07