![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein CD1, alpha-3 domain [88615] (5 species) |
![]() | Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (10 PDB entries) |
![]() | Domain d4x6fa2: 4x6f A:184-278 [269546] Other proteins in same PDB: d4x6fa1, d4x6fa3, d4x6fb_ automated match to d3t8xc2 complexed with 3xu |
PDB Entry: 4x6f (more details), 1.91 Å
SCOPe Domain Sequences for d4x6fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x6fa2 b.1.1.2 (A:184-278) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]} qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw ylratlevaageaadlscrvkhsslegqdivlywe
Timeline for d4x6fa2: