Lineage for d4x6fa1 (4x6f A:9-183)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937580Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (17 PDB entries)
  8. 2937589Domain d4x6fa1: 4x6f A:9-183 [269545]
    Other proteins in same PDB: d4x6fa2, d4x6fa3, d4x6fb_
    automated match to d3t8xc1
    complexed with 3xu

Details for d4x6fa1

PDB Entry: 4x6f (more details), 1.91 Å

PDB Description: cd1a binary complex with sphingomyelin
PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d4x6fa1:

Sequence, based on SEQRES records: (download)

>d4x6fa1 d.19.1.1 (A:9-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
sfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkelet
lfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsfqn
nswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

Sequence, based on observed residues (ATOM records): (download)

>d4x6fa1 d.19.1.1 (A:9-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
sfhviwiasfykqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkeletlfri
rtirsfegirryahelqfeypfeiqvtggcegsflqlayqgsdfvsfqnnswlpypvagn
makhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

SCOPe Domain Coordinates for d4x6fa1:

Click to download the PDB-style file with coordinates for d4x6fa1.
(The format of our PDB-style files is described here.)

Timeline for d4x6fa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d4x6fb_