SCOPe 2.08: Domain d4x6fa1: 4x6f A:9-183

Lineage for d4x6fa1 (4x6f A:9-183)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (17 PDB entries)

8. Domain d4x6fa1: 4x6f A:9-183 [269545]
   Other proteins in same PDB: d4x6fa2, d4x6fa3, d4x6fb_
   automated match to d3t8xc1
   complexed with 3xu

Details for d4x6fa1

PDB Entry: 4x6f, 1.91 Å

PDB Description: cd1a binary complex with sphingomyelin

PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d4x6fa1:

Sequence, based on SEQRES records:

>d4x6fa1 d.19.1.1 (A:9-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
sfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkelet
lfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsfqn
nswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

Sequence, based on observed residues (ATOM records):

>d4x6fa1 d.19.1.1 (A:9-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
sfhviwiasfykqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkeletlfri
rtirsfegirryahelqfeypfeiqvtggcegsflqlayqgsdfvsfqnnswlpypvagn
makhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

Timeline for d4x6fa1:

• d4x6fa1 first appeared in SCOPe 2.05
  
• d4x6fa1 appears in SCOPe 2.07